Beta-2 Laboratories manufactures the beta-2 glycoproteins 1 reagents distributed by Genprice. The Beta-2 Glycoproteins 1 reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact Beta-2. Other Beta-2 products are available in stock. Specificity: Beta-2 Category: Glycoproteins Group: 1
Anti-beta 2 Microglobulin Rabbit Monoclonal Antibody |
|||
M00456-1 | BosterBio | 100ug/vial | EUR 397 |
Description: Rabbit Monoclonal beta 2 Microglobulin Antibody. Validated in IP, IF, WB and tested in Human, Mouse, Rat. |
IL-1-beta Interleukin-1 betaHuman Recombinant Protein |
|||
PROTP01584-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: Interleukin-1 beta Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17000 Dalton.;The IL-1b is purified by proprietary chromatographic techniques. |
Recombinant Human Heregulin Beta -1 Protein |
|||
PROTQ02297-1 | BosterBio | 50ug | EUR 317 |
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues). |
Recombinant Rat IL-1 Beta Protein |
|||
PROTQ63264-1 | BosterBio | 10ug | EUR 317 |
Description: IL-1β is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1α and IL-1β binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1β is a secreted cytokine, IL-1α is predominantly a cell-associated cytokine. Recombinant rat IL-1β is a 17.4 kDa protein containing 153 amino acid residues. |
Canine IL-1 beta Recombinant Protein |
|||
R00101-1 | BosterBio | 5ug/vial | EUR 259 |
Description: IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Canine IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast. |
Equine IFN beta 1 Recombinant Protein |
|||
R02041-1 | BosterBio | 5ug/vial | EUR 259 |
Description: IFN beta is a mammalian Type I inferferon, functionig as a regulator of cellular activity by interacting with cell-surface receptors and activating various signaling pathways. IFN beta produces antiviral, antibacterial, and anticancer properties. Equine IFN beta Recombinant Protein is purified IFN beta produced in yeast. |
Amyloid Beta-Peptide (1-40) (human) |
|||
A1124-1 | ApexBio | 1 mg | EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Anti-Beta Amyloid Antibody |
|||
A00081-2 | BosterBio | 100uL | EUR 443 |
Description: Rabbit Polyclonal Beta Amyloid Antibody. Validated in ELISA, IF, IHC, WB and tested in Human, Mouse. |
Rat Pregnancy Associated Glycoproteins ELISA kit |
|||
E02P0612-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Rat Pregnancy Associated Glycoproteins in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Pregnancy Associated Glycoproteins ELISA kit |
|||
E02P0612-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Rat Pregnancy Associated Glycoproteins in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Pregnancy Associated Glycoproteins ELISA kit |
|||
E02P0612-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Rat Pregnancy Associated Glycoproteins in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Pregnancy Associated Glycoproteins ELISA kit |
|||
E03P0612-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Mouse Pregnancy Associated Glycoproteins in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Pregnancy Associated Glycoproteins ELISA kit |
|||
E03P0612-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Mouse Pregnancy Associated Glycoproteins in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Pregnancy Associated Glycoproteins ELISA kit |
|||
E03P0612-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Mouse Pregnancy Associated Glycoproteins in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Pregnancy Associated Glycoproteins ELISA kit |
|||
E01P0612-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Human Pregnancy Associated Glycoproteins in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Pregnancy Associated Glycoproteins ELISA kit |
|||
E01P0612-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Human Pregnancy Associated Glycoproteins in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Pregnancy Associated Glycoproteins ELISA kit |
|||
E01P0612-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Human Pregnancy Associated Glycoproteins in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |