Anti-p19INK4d Antibody (monoclonal, DCS-100) |
MA1075 |
BosterBio |
100ug/vial |
EUR 400.8 |
Human Monoclonal Laboratories manufactures the ex of 100% human monoclonal antibody reagents distributed by Genprice. The Ex Of 100% Human Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Ex products are available in stock. Specificity: Ex Category: Of Group: 1 Human
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
1 Human information
Cluster Of Differentiation 97 (CD97) Monoclonal Antibody (Human), HRP |
4-MAB410Hu21-HRP |
Cloud-Clone |
-
EUR 339.60
-
EUR 2864.40
-
EUR 828.00
-
EUR 421.20
-
EUR 230.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 97 (CD97). This antibody is labeled with HRP. |
Cluster Of Differentiation 3d (CD3d) Monoclonal Antibody (Human), APC |
4-MAB872Hu22-APC |
Cloud-Clone |
-
EUR 415.20
-
EUR 3940.80
-
EUR 1096.80
-
EUR 528.00
-
EUR 262.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 3d (CD3d). This antibody is labeled with APC. |
Cluster Of Differentiation 3d (CD3d) Monoclonal Antibody (Human), Cy3 |
4-MAB872Hu22-Cy3 |
Cloud-Clone |
-
EUR 504.00
-
EUR 5204.40
-
EUR 1413.60
-
EUR 655.20
-
EUR 301.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 3d (CD3d). This antibody is labeled with Cy3. |
Cluster Of Differentiation 3d (CD3d) Monoclonal Antibody (Human), HRP |
4-MAB872Hu22-HRP |
Cloud-Clone |
-
EUR 379.20
-
EUR 3434.40
-
EUR 970.80
-
EUR 477.60
-
EUR 248.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 3d (CD3d). This antibody is labeled with HRP. |
Cluster Of Differentiation 34 (CD34) Monoclonal Antibody (Human), APC |
4-MAB959Hu21-APC |
Cloud-Clone |
-
EUR 415.20
-
EUR 3951.60
-
EUR 1100.40
-
EUR 529.20
-
EUR 264.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 34 (CD34). This antibody is labeled with APC. |
Cluster Of Differentiation 34 (CD34) Monoclonal Antibody (Human), Cy3 |
4-MAB959Hu21-Cy3 |
Cloud-Clone |
-
EUR 504.00
-
EUR 5218.80
-
EUR 1417.20
-
EUR 656.40
-
EUR 302.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 34 (CD34). This antibody is labeled with Cy3. |
Cluster Of Differentiation 34 (CD34) Monoclonal Antibody (Human), HRP |
4-MAB959Hu21-HRP |
Cloud-Clone |
-
EUR 379.20
-
EUR 3444.00
-
EUR 973.20
-
EUR 478.80
-
EUR 248.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 34 (CD34). This antibody is labeled with HRP. |
Cluster Of Differentiation 8a (CD8a) Monoclonal Antibody (Human), FITC |
4-MAB099Hu22-FITC |
Cloud-Clone |
-
EUR 325.20
-
EUR 2736.00
-
EUR 792.00
-
EUR 403.20
-
EUR 220.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 8a (CD8a). This antibody is labeled with FITC. |
Cluster Of Differentiation 97 (CD97) Monoclonal Antibody (Human), FITC |
4-MAB410Hu21-FITC |
Cloud-Clone |
-
EUR 319.20
-
EUR 2649.60
-
EUR 770.40
-
EUR 393.60
-
EUR 218.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 97 (CD97). This antibody is labeled with FITC. |
Cluster Of Differentiation 3d (CD3d) Monoclonal Antibody (Human), FITC |
4-MAB872Hu22-FITC |
Cloud-Clone |
-
EUR 356.40
-
EUR 3176.40
-
EUR 901.20
-
EUR 446.40
-
EUR 234.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 3d (CD3d). This antibody is labeled with FITC. |
Cluster Of Differentiation 34 (CD34) Monoclonal Antibody (Human), FITC |
4-MAB959Hu21-FITC |
Cloud-Clone |
-
EUR 356.40
-
EUR 3184.80
-
EUR 903.60
-
EUR 447.60
-
EUR 235.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 34 (CD34). This antibody is labeled with FITC. |
Anti-p19INK4d Antibody (monoclonal, DCS-100) |
MA1075 |
BosterBio |
100ug/vial |
EUR 400.8 |
Anti-alpha-Adaptin Antibody (monoclonal, 100/2) |
MA1105 |
BosterBio |
100ug/vial |
EUR 352.8 |
Suppression Of Tumorigenicity 14 (ST14) Monoclonal Antibody (Human), APC |
4-MAP657Hu21-APC |
Cloud-Clone |
-
EUR 456.00
-
EUR 4534.80
-
EUR 1245.60
-
EUR 588.00
-
EUR 280.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Suppression Of Tumorigenicity 14 (ST14). This antibody is labeled with APC. |
Suppression Of Tumorigenicity 14 (ST14) Monoclonal Antibody (Human), Cy3 |
4-MAP657Hu21-Cy3 |
Cloud-Clone |
-
EUR 558.00
-
EUR 5996.40
-
EUR 1611.60
-
EUR 734.40
-
EUR 325.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Suppression Of Tumorigenicity 14 (ST14). This antibody is labeled with Cy3. |
Suppression Of Tumorigenicity 14 (ST14) Monoclonal Antibody (Human), HRP |
4-MAP657Hu21-HRP |
Cloud-Clone |
-
EUR 415.20
-
EUR 3949.20
-
EUR 1099.20
-
EUR 529.20
-
EUR 264.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Suppression Of Tumorigenicity 14 (ST14). This antibody is labeled with HRP. |
Suppression Of Tumorigenicity 14 (ST14) Monoclonal Antibody (Human), PE |
4-MAP657Hu21-PE |
Cloud-Clone |
-
EUR 388.80
-
EUR 3651.60
-
EUR 1020.00
-
EUR 494.40
-
EUR 248.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Suppression Of Tumorigenicity 14 (ST14). This antibody is labeled with PE. |