Ex Of 100% Human Monoclonal Antibody

Anti-p19INK4d Antibody (monoclonal, DCS-100)

MA1075 100ug/vial
EUR 400.8

Human Monoclonal Laboratories manufactures the ex of 100% human monoclonal antibody reagents distributed by Genprice. The Ex Of 100% Human Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Ex products are available in stock. Specificity: Ex Category: Of Group: 1 Human

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

1 Human information

Cluster Of Differentiation 97 (CD97) Monoclonal Antibody (Human), HRP

4-MAB410Hu21-HRP
  • EUR 339.60
  • EUR 2864.40
  • EUR 828.00
  • EUR 421.20
  • EUR 230.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 97 (CD97). This antibody is labeled with HRP.

Cluster Of Differentiation 3d (CD3d) Monoclonal Antibody (Human), APC

4-MAB872Hu22-APC
  • EUR 415.20
  • EUR 3940.80
  • EUR 1096.80
  • EUR 528.00
  • EUR 262.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 3d (CD3d). This antibody is labeled with APC.

Cluster Of Differentiation 3d (CD3d) Monoclonal Antibody (Human), Cy3

4-MAB872Hu22-Cy3
  • EUR 504.00
  • EUR 5204.40
  • EUR 1413.60
  • EUR 655.20
  • EUR 301.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 3d (CD3d). This antibody is labeled with Cy3.

Cluster Of Differentiation 3d (CD3d) Monoclonal Antibody (Human), HRP

4-MAB872Hu22-HRP
  • EUR 379.20
  • EUR 3434.40
  • EUR 970.80
  • EUR 477.60
  • EUR 248.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 3d (CD3d). This antibody is labeled with HRP.

Cluster Of Differentiation 34 (CD34) Monoclonal Antibody (Human), APC

4-MAB959Hu21-APC
  • EUR 415.20
  • EUR 3951.60
  • EUR 1100.40
  • EUR 529.20
  • EUR 264.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 34 (CD34). This antibody is labeled with APC.

Cluster Of Differentiation 34 (CD34) Monoclonal Antibody (Human), Cy3

4-MAB959Hu21-Cy3
  • EUR 504.00
  • EUR 5218.80
  • EUR 1417.20
  • EUR 656.40
  • EUR 302.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 34 (CD34). This antibody is labeled with Cy3.

Cluster Of Differentiation 34 (CD34) Monoclonal Antibody (Human), HRP

4-MAB959Hu21-HRP
  • EUR 379.20
  • EUR 3444.00
  • EUR 973.20
  • EUR 478.80
  • EUR 248.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 34 (CD34). This antibody is labeled with HRP.

Cluster Of Differentiation 8a (CD8a) Monoclonal Antibody (Human), FITC

4-MAB099Hu22-FITC
  • EUR 325.20
  • EUR 2736.00
  • EUR 792.00
  • EUR 403.20
  • EUR 220.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 8a (CD8a). This antibody is labeled with FITC.

Cluster Of Differentiation 97 (CD97) Monoclonal Antibody (Human), FITC

4-MAB410Hu21-FITC
  • EUR 319.20
  • EUR 2649.60
  • EUR 770.40
  • EUR 393.60
  • EUR 218.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 97 (CD97). This antibody is labeled with FITC.

Cluster Of Differentiation 3d (CD3d) Monoclonal Antibody (Human), FITC

4-MAB872Hu22-FITC
  • EUR 356.40
  • EUR 3176.40
  • EUR 901.20
  • EUR 446.40
  • EUR 234.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 3d (CD3d). This antibody is labeled with FITC.

Cluster Of Differentiation 34 (CD34) Monoclonal Antibody (Human), FITC

4-MAB959Hu21-FITC
  • EUR 356.40
  • EUR 3184.80
  • EUR 903.60
  • EUR 447.60
  • EUR 235.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Cluster Of Differentiation 34 (CD34). This antibody is labeled with FITC.

Anti-p19INK4d Antibody (monoclonal, DCS-100)

MA1075 100ug/vial
EUR 400.8

Anti-alpha-Adaptin Antibody (monoclonal, 100/2)

MA1105 100ug/vial
EUR 352.8

Suppression Of Tumorigenicity 14 (ST14) Monoclonal Antibody (Human), APC

4-MAP657Hu21-APC
  • EUR 456.00
  • EUR 4534.80
  • EUR 1245.60
  • EUR 588.00
  • EUR 280.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Suppression Of Tumorigenicity 14 (ST14). This antibody is labeled with APC.

Suppression Of Tumorigenicity 14 (ST14) Monoclonal Antibody (Human), Cy3

4-MAP657Hu21-Cy3
  • EUR 558.00
  • EUR 5996.40
  • EUR 1611.60
  • EUR 734.40
  • EUR 325.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Suppression Of Tumorigenicity 14 (ST14). This antibody is labeled with Cy3.

Suppression Of Tumorigenicity 14 (ST14) Monoclonal Antibody (Human), HRP

4-MAP657Hu21-HRP
  • EUR 415.20
  • EUR 3949.20
  • EUR 1099.20
  • EUR 529.20
  • EUR 264.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Suppression Of Tumorigenicity 14 (ST14). This antibody is labeled with HRP.

Suppression Of Tumorigenicity 14 (ST14) Monoclonal Antibody (Human), PE

4-MAP657Hu21-PE
  • EUR 388.80
  • EUR 3651.60
  • EUR 1020.00
  • EUR 494.40
  • EUR 248.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Suppression Of Tumorigenicity 14 (ST14). This antibody is labeled with PE.