Salivary Protein 1 (Sp 1) Iga Antibodies

Lab Reagents

Iga Antibody Laboratories manufactures the salivary protein 1 (sp 1) iga antibodies reagents distributed by Genprice. The Salivary Protein 1 (Sp 1) Iga Antibodies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga antibody. Other Salivary products are available in stock. Specificity: Salivary Category: Protein Group: 1 (Sp

1 (Sp information

Proadrenomedullin (1-20) (human)
SP-100051-1 1 mg
EUR 196.8

Mitochondria (Marker for Human Cells, Granular RCC's & Salivary Tumors); Clone 113-1 (Concentrate)
RA0392-C.1 0.1 ml
EUR 150

Gastrin I (1-14) (human)
SP-100258-1 1 mg
EUR 196.8

Glucagon-Like Peptide I (GLP1/GLP-1, 7-37); GLP-1 (7-37)
SP-51018-1 1 mg
EUR 343.2

PACAP (1-38), Human, Ovine, Rat
SP-52290-1 0.5 mg
EUR 421.2

Atrial Natriuretic Peptide (1-28), Rat
SP-55278-1 0.5 mg
EUR 343.2

Adrenomedullin (ADM/AM, 1-50), rat
SP-100046-1 1 mg
EUR 634.8

Galanin Message Associated Peptide (1-41), amide; GMAP (1-41), amide; Preprogalanin (65-105), amide
SP-101039-1 1 mg
EUR 489.6

Human Immunoglobulin A (IgA) AssayMax ELISA Kit
EI7001-1 96 Well Plate
EUR 475.2

Biotin-Parathyroid Hormone (PTH, 1-34), human
SP-101127-1 1 mg
EUR 343.2

[D-Ala2]-GRF (1-29) amide (human)
SP-89085-1 1 mg
EUR 343.2

Gastrin Releasing Peptide (GRP) (1-16) (porcine)
SP-100261-1 1 mg
EUR 196.8

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein
P1054-1 1 mg
EUR 4736.4
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)]
SP-55426-1 0.5 mg
EUR 795.6

Neuropeptide Y (NPY) (1-24) amide (human, rat)
SP-100066-1 1 mg
EUR 270

HIV Integrase Protein Inhibitor (1) [His-Cys-Lys-phe-Trp-Trp-OH; MW: 906.1]
SP-52261-1 1 mg
EUR 169.2

Anti-Human IgA Rabbit Monoclonal Antibody, Clone#RM128
M07514-1 100ug
EUR 450
Description: Anti-Human IgA Rabbit Monoclonal Antibody, Clone#RM128 tested in ICC, IHC, FC, ELISA, reactive to Human