Salivary Protein 1 (Sp 1) Iga Antibodies

Lab Reagents

Iga Antibody Laboratories manufactures the salivary protein 1 (sp 1) iga antibodies reagents distributed by Genprice. The Salivary Protein 1 (Sp 1) Iga Antibodies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga antibody. Other Salivary products are available in stock. Specificity: Salivary Category: Protein Group: 1 (Sp

1 (Sp information

Sp-5,6-dichloro-cBIMPS (sodium salt)
C3728-1 1 mg
EUR 326
Description: Ki: 30 nMSp-5,6-dichloro-cBIMPS is a PKA activator.In cell biology, protein kinase A (PKA) is a family of enzymes whose activity is dependent on cellular levels of cyclic AMP. PKA is also known as cAMP-dependent protein kinase.

Gastrin I (1-14) (human)
SP-100258-1 1 mg
EUR 164

Glucagon-Like Peptide I (GLP1/GLP-1, 7-37); GLP-1 (7-37)
SP-51018-1 1 mg
EUR 286

Mitochondria (Marker for Human Cells, Granular RCC's & Salivary Tumors); Clone 113-1 (Concentrate)
RA0392-C.1 0.1 ml
EUR 125

Adrenomedullin (ADM/AM, 1-50), rat
SP-100046-1 1 mg
EUR 529

PACAP (1-38), Human, Ovine, Rat
SP-52290-1 0.5 mg
EUR 351

Atrial Natriuretic Peptide (1-28), Rat
SP-55278-1 0.5 mg
EUR 286

Galanin Message Associated Peptide (1-41), amide; GMAP (1-41), amide; Preprogalanin (65-105), amide
SP-101039-1 1 mg
EUR 408

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein
P1054-1 1 mg
EUR 3947
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

Gastrin Releasing Peptide (GRP) (1-16) (porcine)
SP-100261-1 1 mg
EUR 164

Biotin-Parathyroid Hormone (PTH, 1-34), human
SP-101127-1 1 mg
EUR 286

[D-Ala2]-GRF (1-29) amide (human)
SP-89085-1 1 mg
EUR 286

HIV Integrase Protein Inhibitor (1) [His-Cys-Lys-phe-Trp-Trp-OH; MW: 906.1]
SP-52261-1 1 mg
EUR 141

MCP-1 Monocyte Chemotactic Protein-1 Mouse Recombinant Protein (CCL2)
PROTP10148-1 Regular: 10ug
EUR 317
Description: Monocyte Chemotactic Protein-1 Mouse Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 125 amino acids and having a molecular mass of 14 kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.

MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)
PROTP13500-1 Regular: 20ug
EUR 317
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.

Neuropeptide Y (NPY) (1-24) amide (human, rat)
SP-100066-1 1 mg
EUR 225

Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)]
SP-55426-1 0.5 mg
EUR 663