Lab Reagents
Iga Antibody Laboratories manufactures the salivary protein 1 (sp 1) iga antibodies* reagents distributed by Genprice. The Salivary Protein 1 (Sp 1) Iga Antibodies* reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga antibody. Other Salivary products are available in stock. Specificity: Salivary Category: Protein Group: 1 (Sp
1 (Sp information
Sp-5,6-dichloro-cBIMPS (sodium salt) |
C3728-1 |
ApexBio |
1 mg |
EUR 326 |
Description: Ki: 30 nMSp-5,6-dichloro-cBIMPS is a PKA activator.In cell biology, protein kinase A (PKA) is a family of enzymes whose activity is dependent on cellular levels of cyclic AMP. PKA is also known as cAMP-dependent protein kinase. |
Glucagon-Like Peptide I (GLP1/GLP-1, 7-37); GLP-1 (7-37) |
SP-51018-1 |
Alpha Diagnostics |
1 mg |
EUR 286 |
Mitochondria (Marker for Human Cells, Granular RCC's & Salivary Tumors); Clone 113-1 (Concentrate) |
RA0392-C.1 |
ScyTek Laboratories |
0.1 ml |
EUR 125 |
Galanin Message Associated Peptide (1-41), amide; GMAP (1-41), amide; Preprogalanin (65-105), amide |
SP-101039-1 |
Alpha Diagnostics |
1 mg |
EUR 408 |
Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein |
P1054-1 |
ApexBio |
1 mg |
EUR 3947 |
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation |
Gastrin Releasing Peptide (GRP) (1-16) (porcine) |
SP-100261-1 |
Alpha Diagnostics |
1 mg |
EUR 164 |
Biotin-Parathyroid Hormone (PTH, 1-34), human |
SP-101127-1 |
Alpha Diagnostics |
1 mg |
EUR 286 |
HIV Integrase Protein Inhibitor (1) [His-Cys-Lys-phe-Trp-Trp-OH; MW: 906.1] |
SP-52261-1 |
Alpha Diagnostics |
1 mg |
EUR 141 |
MCP-1 Monocyte Chemotactic Protein-1 Mouse Recombinant Protein (CCL2) |
PROTP10148-1 |
BosterBio |
Regular: 10ug |
EUR 317 |
Description: Monocyte Chemotactic Protein-1 Mouse Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 125 amino acids and having a molecular mass of 14 kDa. ;The MCP-1 is purified by proprietary chromatographic techniques. |
MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2) |
PROTP13500-1 |
BosterBio |
Regular: 20ug |
EUR 317 |
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques. |
Neuropeptide Y (NPY) (1-24) amide (human, rat) |
SP-100066-1 |
Alpha Diagnostics |
1 mg |
EUR 225 |
Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)] |
SP-55426-1 |
Alpha Diagnostics |
0.5 mg |
EUR 663 |